Lineage for d1pybc_ (1pyb C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 373898Fold b.40: OB-fold [50198] (10 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 374537Superfamily b.40.4: Nucleic acid-binding proteins [50249] (12 families) (S)
  5. 374760Family b.40.4.4: Myf domain [50277] (6 proteins)
  6. 374783Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 374784Species Aquifex aeolicus [TaxId:63363] [101763] (1 PDB entry)
    aq_422; putative methionyl-tRNA synthetase beta subunit
  8. 374787Domain d1pybc_: 1pyb C: [95332]

Details for d1pybc_

PDB Entry: 1pyb (more details), 2.5 Å

PDB Description: crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein

SCOP Domain Sequences for d1pybc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pybc_ b.40.4.4 (C:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus}
aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls

SCOP Domain Coordinates for d1pybc_:

Click to download the PDB-style file with coordinates for d1pybc_.
(The format of our PDB-style files is described here.)

Timeline for d1pybc_: