Lineage for d1pyba_ (1pyb A:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2058098Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2059387Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 2059726Family b.40.4.4: Myf domain [50277] (7 proteins)
  6. 2059756Protein Structure-specific tRNA-binding protein TRBP111 [89328] (2 species)
  7. 2059757Species Aquifex aeolicus [TaxId:63363] [101763] (1 PDB entry)
    aq_422; putative methionyl-tRNA synthetase beta subunit
  8. 2059758Domain d1pyba_: 1pyb A: [95330]

Details for d1pyba_

PDB Entry: 1pyb (more details), 2.5 Å

PDB Description: crystal structure of aquifex aeolicus trbp111: a structure-specific trna binding protein
PDB Compounds: (A:) methionyl-tRNA synthetase beta subunit

SCOPe Domain Sequences for d1pyba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pyba_ b.40.4.4 (A:) Structure-specific tRNA-binding protein TRBP111 {Aquifex aeolicus [TaxId: 63363]}
aligiedflkvdlrvakvlsaervegsekllkltlslgdeertvvagiakyytpeelvgk
kivivanlkprkifgiesqgmilaasdgenlsvivpdrdvkegakls

SCOPe Domain Coordinates for d1pyba_:

Click to download the PDB-style file with coordinates for d1pyba_.
(The format of our PDB-style files is described here.)

Timeline for d1pyba_: