Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies) core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest |
Superfamily d.79.3: L30e-like [55315] (3 families) |
Family d.79.3.1: L30e/L7ae ribosomal proteins [55316] (4 proteins) |
Protein Ribosomal protein L7ae [55319] (7 species) |
Species Pyrococcus abyssi [TaxId:29292] [103081] (2 PDB entries) |
Domain d1pxwa_: 1pxw A: [95305] |
PDB Entry: 1pxw (more details), 1.94 Å
SCOPe Domain Sequences for d1pxwa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pxwa_ d.79.3.1 (A:) Ribosomal protein L7ae {Pyrococcus abyssi [TaxId: 29292]} megwmmakpsyvkfevpkelaekalqaveiardtgkirkgtnettkavergqaklviiae dvdpeeivahlpplceekeipyiyvpskkelgaaagievaaasvaiiepgkardlveeia mkvrelmk
Timeline for d1pxwa_: