SCOPe 2.05: Domain d1px8b1: 1px8 B:1-13,B:360-500

Lineage for d1px8b1 (1px8 B:1-13,B:360-500)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (6 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.2: Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 [89388] (4 proteins)
   interrupted by the catalytic domain; the C-terminal core is similar to the alpha-amylase domain

6. Protein Beta-D-xylosidase [101926] (2 species)
   glycosyl hydrolase family 39

7. Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [101927] (2 PDB entries)

8. Domain d1px8b1: 1px8 B:1-13,B:360-500 [95283]
   Other proteins in same PDB: d1px8a2, d1px8b2
   complexed with xyp

Details for d1px8b1

PDB Entry: 1px8, 2.4 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase

PDB Compounds: (B:) beta-xylosidase

SCOPe Domain Sequences for d1px8b1:

Sequence; same for both SEQRES and ATOM records:

>d1px8b1 b.71.1.2 (B:1-13,B:360-500) Beta-D-xylosidase {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
mikvrvpdfsdkkXemlyrdehmlvtrrddgsvaliawnevmdktenpdedyeveipvrf
rdvfikrqlideehgnpwgtwihmgrprypskeqvntlrevakpeimtsqpvandgylnl
kfklgknavvlyelteridesstyiglddskingy

Timeline for d1px8b1:

• d1px8b1 first appeared in SCOP 1.67
  
• d1px8b1 appears in SCOPe 2.04
  
• d1px8b1 appears in SCOPe 2.06
  
• d1px8b1 appears in the current release, SCOPe 2.08