Lineage for d1px8a2 (1px8 A:14-359)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2093018Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2093694Family c.1.8.3: beta-glycanases [51487] (27 proteins)
    consist of a number of sequence families
  6. 2093745Protein Beta-D-xylosidase, catalytic domain [102077] (2 species)
    glycosyl hydrolase family 39
  7. 2093771Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries)
  8. 2093776Domain d1px8a2: 1px8 A:14-359 [95282]
    Other proteins in same PDB: d1px8a1, d1px8b1
    complexed with xyp

Details for d1px8a2

PDB Entry: 1px8 (more details), 2.4 Å

PDB Description: crystal structure of beta-d-xylosidase from thermoanaerobacterium saccharolyticum, a family 39 glycoside hydrolase
PDB Compounds: (A:) beta-xylosidase

SCOPe Domain Sequences for d1px8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1px8a2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]}
fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev
kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl
vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl
kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml
nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs
ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge

SCOPe Domain Coordinates for d1px8a2:

Click to download the PDB-style file with coordinates for d1px8a2.
(The format of our PDB-style files is described here.)

Timeline for d1px8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1px8a1