Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) |
Family c.1.8.3: beta-glycanases [51487] (27 proteins) consist of a number of sequence families |
Protein Beta-D-xylosidase, catalytic domain [102077] (2 species) glycosyl hydrolase family 39 |
Species Thermoanaerobacterium saccharolyticum [TaxId:28896] [102078] (2 PDB entries) |
Domain d1px8a2: 1px8 A:14-359 [95282] Other proteins in same PDB: d1px8a1, d1px8b1 complexed with xyp |
PDB Entry: 1px8 (more details), 2.4 Å
SCOPe Domain Sequences for d1px8a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px8a2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} fsdrwrycvgtgrlglalqkeyietlkyvkenidfkyirghgllcddvgiyredvvgdev kpfynftyidrifdsfleigirpfveigfmpkklasgtqtvfywegnvtppkdyekwsdl vkavlhhfisrygieevlkwpfeiwnepnlkefwkdadekeyfklykvtakaikevnenl kvggpaicggadywiedflnfcyeenvpvdfvsrhaytskqgeytphliyqeimpseyml nefktvreiiknshfpnlpfhiteyntsyspqnpvhdtpfnaayiarilseggdyvdsfs ywtfsdvfeerdvprsqfhggfglvalnmipkptfytfkffnamge
Timeline for d1px8a2: