Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.30: PreATP-grasp domain [52439] (1 superfamily) 3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands possible rudiment form of Rossmann-fold domain |
Superfamily c.30.1: PreATP-grasp domain [52440] (6 families) precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function |
Family c.30.1.5: Synapsin domain [52463] (2 proteins) |
Protein Synapsin I [52464] (2 species) |
Species Rat (Rattus norvegicus) [TaxId:10116] [102287] (2 PDB entries) |
Domain d1px2b1: 1px2 B:113-213 [95275] Other proteins in same PDB: d1px2a2, d1px2b2 complexed with atp, ca |
PDB Entry: 1px2 (more details), 2.23 Å
SCOP Domain Sequences for d1px2b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1px2b1 c.30.1.5 (B:113-213) Synapsin I {Rat (Rattus norvegicus)} arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngv kvvrslkpdfvlirqhafsmarngdyrslviglqyagipsv
Timeline for d1px2b1: