Lineage for d1pw9c1 (1pw9 C:235-355)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2234637Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 2234638Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 2234639Family d.169.1.1: C-type lectin domain [56437] (29 proteins)
    Pfam PF00059
  6. 2235028Protein Surfactant protein, lectin domain [56461] (3 species)
  7. 2235029Species Human (Homo sapiens), SP-D [TaxId:9606] [56462] (9 PDB entries)
  8. 2235038Domain d1pw9c1: 1pw9 C:235-355 [95209]
    Other proteins in same PDB: d1pw9a2, d1pw9b2, d1pw9c2
    complexed with ca

Details for d1pw9c1

PDB Entry: 1pw9 (more details), 1.6 Å

PDB Description: high resolution crystal structure of an active recombinant fragment of human lung surfactant protein d
PDB Compounds: (C:) Pulmonary surfactant-associated protein D

SCOPe Domain Sequences for d1pw9c1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pw9c1 d.169.1.1 (C:235-355) Surfactant protein, lectin domain {Human (Homo sapiens), SP-D [TaxId: 9606]}
pngqsvgekifktagfvkpfteaqllctqaggqlasprsaaenaalqqlvvakneaafls
mtdsktegkftyptgeslvysnwapgepnddggsedcveiftngkwndracgekrlvvce
f

SCOPe Domain Coordinates for d1pw9c1:

Click to download the PDB-style file with coordinates for d1pw9c1.
(The format of our PDB-style files is described here.)

Timeline for d1pw9c1: