Lineage for d1pvgb1 (1pvg B:246-405)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 598219Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
    core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover
  4. 598220Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (12 families) (S)
  5. 598290Family d.14.1.3: DNA gyrase/MutL, second domain [54224] (6 proteins)
  6. 598315Protein DNA topoisomerase II [102751] (1 species)
  7. 598316Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [102752] (2 PDB entries)
  8. 598318Domain d1pvgb1: 1pvg B:246-405 [95163]
    Other proteins in same PDB: d1pvga2, d1pvgb2
    complexed with anp, mg

Details for d1pvgb1

PDB Entry: 1pvg (more details), 1.8 Å

PDB Description: crystal structure of the atpase region of saccharomyces cerevisiae topoisomerase ii

SCOP Domain Sequences for d1pvgb1:

Sequence, based on SEQRES records: (download)

>d1pvgb1 d.14.1.3 (B:246-405) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae)}
nfknyvelylkslekkrqldngedgaaksdiptilyerinnrwevafavsdisfqqisfv
nsiattmggthvnyitdqivkkiseilkkkkkksvksfqiknnmfifinclienpaftsq
tkeqlttrvkdfgsrceipleyinkimktdlatrmfeiad

Sequence, based on observed residues (ATOM records): (download)

>d1pvgb1 d.14.1.3 (B:246-405) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae)}
nfknyvelylksleiptilyerinnrwevafavsdisfqqisfvnsiattmggthvnyit
dqivkkiseilkksvksfqiknnmfifinclienpaftsqtkeqlttrvkdfgsrceipl
eyinkimktdlatrmfeiad

SCOP Domain Coordinates for d1pvgb1:

Click to download the PDB-style file with coordinates for d1pvgb1.
(The format of our PDB-style files is described here.)

Timeline for d1pvgb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1pvgb2