Class c: Alpha and beta proteins (a/b) [51349] (130 folds) |
Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies) 3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest |
Superfamily c.55.2: Creatinase/prolidase N-terminal domain [53092] (1 family) |
Family c.55.2.1: Creatinase/prolidase N-terminal domain [53093] (2 proteins) |
Protein Aminopeptidase P [53096] (2 species) synonym: Xaa-Pro dipeptidase, prolidase |
Species Archaeon Pyrococcus furiosus [TaxId:2261] [102481] (1 PDB entry) |
Domain d1pv9a1: 1pv9 A:8-124 [95157] Other proteins in same PDB: d1pv9a2, d1pv9b2 |
PDB Entry: 1pv9 (more details), 2 Å
SCOP Domain Sequences for d1pv9a1:
Sequence, based on SEQRES records: (download)
>d1pv9a1 c.55.2.1 (A:8-124) Aminopeptidase P {Archaeon Pyrococcus furiosus} lvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemakeeskl pvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksnvkefkkiddvikdlrii
>d1pv9a1 c.55.2.1 (A:8-124) Aminopeptidase P {Archaeon Pyrococcus furiosus} lvkfmdensidrvfiakpvnvyyfsgtsplgggyiivdgdeatlyvpeleyemakeeskl pvvkfkkfdeiyeilkntetlgiegtlsysmvenfkeksvkefkkiddvikdlrii
Timeline for d1pv9a1: