Lineage for d1pv7b_ (1pv7 B:)

  1. Root: SCOP 1.67
  2. 425432Class f: Membrane and cell surface proteins and peptides [56835] (42 folds)
  3. 426945Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 426946Superfamily f.38.1: MFS general substrate transporter [103473] (2 families) (S)
  5. 426951Family f.38.1.2: LacY-like proton/sugar symporter [103477] (1 protein)
  6. 426952Protein Lactose permease [103478] (1 species)
  7. 426953Species Escherichia coli [TaxId:562] [103479] (2 PDB entries)
  8. 426955Domain d1pv7b_: 1pv7 B: [95154]
    complexed with tdg; mutant

Details for d1pv7b_

PDB Entry: 1pv7 (more details), 3.6 Å

PDB Description: crystal structure of lactose permease with tdg

SCOP Domain Sequences for d1pv7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv7b_ f.38.1.2 (B:) Lactose permease {Escherichia coli}
myylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtgiifaaislfsllfq
plfgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfna
gapaveafiekvsrrsnfefgrarmfgcvgwalgasivgimftinnqfvfwlgsgcalil
avllffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfd
qqfanfftsffatgeqgtrvfgyvttmgellnasimffapliinriggknalllagtims
vriigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkql
amifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsllrrqvneva

SCOP Domain Coordinates for d1pv7b_:

Click to download the PDB-style file with coordinates for d1pv7b_.
(The format of our PDB-style files is described here.)

Timeline for d1pv7b_: