Lineage for d1pv6b_ (1pv6 B:)

  1. Root: SCOPe 2.07
  2. 2626587Class f: Membrane and cell surface proteins and peptides [56835] (60 folds)
  3. 2633526Fold f.38: MFS general substrate transporter [103472] (1 superfamily)
    12 transmembrane helices; duplication: the N- and C-terminal halves are structurally similar
  4. 2633527Superfamily f.38.1: MFS general substrate transporter [103473] (4 families) (S)
  5. 2633532Family f.38.1.2: LacY-like proton/sugar symporter [103477] (2 proteins)
    automatically mapped to Pfam PF07690
    automatically mapped to Pfam PF01306
  6. 2633533Protein Lactose permease [103478] (1 species)
  7. 2633534Species Escherichia coli [TaxId:562] [103479] (3 PDB entries)
  8. 2633538Domain d1pv6b_: 1pv6 B: [95152]

Details for d1pv6b_

PDB Entry: 1pv6 (more details), 3.5 Å

PDB Description: crystal structure of lactose permease
PDB Compounds: (B:) lactose permease

SCOPe Domain Sequences for d1pv6b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv6b_ f.38.1.2 (B:) Lactose permease {Escherichia coli [TaxId: 562]}
myylkntnfwmfglffffyffimgayfpffpiwlhdinhisksdtgiifaaislfsllfq
plfgllsdklglrkyllwiitgmlvmfapffififgpllqynilvgsivggiylgfcfna
gapaveafiekvsrrsnfefgrarmfgcvgwalgasivgimftinnqfvfwlgsgcalil
avllffaktdapssatvanavganhsafslklalelfrqpklwflslyvigvsctydvfd
qqfanfftsffatgeqgtrvfgyvttmgellnasimffapliinriggknalllagtims
vriigssfatsalevvilktlhmfevpfllvgcfkyitsqfevrfsatiylvcfcffkql
amifmsvlagnmyesigfqgaylvlglvalgftlisvftlsgpgplsllrrqvneva

SCOPe Domain Coordinates for d1pv6b_:

Click to download the PDB-style file with coordinates for d1pv6b_.
(The format of our PDB-style files is described here.)

Timeline for d1pv6b_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pv6a_