Lineage for d1pv5a_ (1pv5 A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 740929Fold d.251: Hypothetical protein YwqG [103031] (1 superfamily)
    duplication: contains two similar beta-x-beta(4) motifs swapped with the first strands
  4. 740930Superfamily d.251.1: Hypothetical protein YwqG [103032] (1 family) (S)
  5. 740931Family d.251.1.1: Hypothetical protein YwqG [103033] (1 protein)
  6. 740932Protein Hypothetical protein YwqG [103034] (1 species)
  7. 740933Species Bacillus subtilis [TaxId:1423] [103035] (1 PDB entry)
  8. 740934Domain d1pv5a_: 1pv5 A: [95150]
    structural genomics

Details for d1pv5a_

PDB Entry: 1pv5 (more details), 1.75 Å

PDB Description: Structure of Protein of Unknown Function YwqG from Bacillus subtilis
PDB Compounds: (A:) Hypothetical protein ywqG

SCOP Domain Sequences for d1pv5a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pv5a_ d.251.1.1 (A:) Hypothetical protein YwqG {Bacillus subtilis [TaxId: 1423]}
mnhlpekmrpyrdlleksakeyvklnvrkgktgrydskiagdpyfpkhetyptdengqpm
kllaqinfshipqldgypssgilqfyisvhddvyglnfddrceqknfrviyfenivendd
elvsdfsfigtgecdfpilseaavepvkssewvlptdfqfeqytgmetmeffgqfgedee
diynelaengfghkiggyasftqhdpreyaykehtimllqidsdddidsmwgdvgianff
itpedlrkkdfsnvlynwdcs

SCOP Domain Coordinates for d1pv5a_:

Click to download the PDB-style file with coordinates for d1pv5a_.
(The format of our PDB-style files is described here.)

Timeline for d1pv5a_: