SCOP 1.69: Domain d1ps9a2: 1ps9 A:466-627

Lineage for d1ps9a2 (1ps9 A:466-627)

1. Root: SCOP 1.69

2. Class c: Alpha and beta proteins (a/b) [51349] (136 folds)

3. Fold c.3: FAD/NAD(P)-binding domain [51904] (1 superfamily)
   core: 3 layers, b/b/a; central parallel beta-sheet of 5 strands, order 32145; top antiparallel beta-sheet of 3 strands, meander

4. Superfamily c.3.1: FAD/NAD(P)-binding domain [51905] (5 families)

5. Family c.3.1.1: C-terminal domain of adrenodoxin reductase-like [51906] (5 proteins)

6. Protein 2,4-dienoyl-CoA reductase, C-terminal domain [102177] (1 species)

7. Species Escherichia coli [TaxId:562] [102178] (1 PDB entry)

8. Domain d1ps9a2: 1ps9 A:466-627 [95077]
   Other proteins in same PDB: d1ps9a1, d1ps9a3

Details for d1ps9a2

PDB Entry: 1ps9, 2.2 Å

PDB Description: the crystal structure and reaction mechanism of e. coli 2,4-dienoyl coa reductase

SCOP Domain Sequences for d1ps9a2:

Sequence; same for both SEQRES and ATOM records:

>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli}
vprtppidgidhpkvlsyldvlrdkapvgnkvaiigcggigfdtamylsqpgestsqnia
gfcnewgidsslqqagglspqgmqiprsprqivmlqrkaskpgqglgkttgwihrttlls
rgvkmipgvsyqkidddglhvvingetqvlavdnvvicagqe

Timeline for d1ps9a2:

• d1ps9a2 first appeared in SCOP 1.67
  
• d1ps9a2 appears in SCOP 1.71
  
• d1ps9a2 appears in the current release, SCOPe 2.08