SCOPe 2.01: Domain d1prza_: 1prz A:

Lineage for d1prza_ (1prz A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
   consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold

4. Superfamily d.265.1: Pseudouridine synthase [55120] (4 families)
   the active site is the most conserved structural region of the superfamily and is located between the subdomains

5. Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (3 proteins)
   contains N-terminal alpha-L RNA-binding motif

6. Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species)

7. Species Escherichia coli [TaxId:562] [103020] (3 PDB entries)
   Uniprot P33643

8. Domain d1prza_: 1prz A: [95064]

Details for d1prza_

PDB Entry: 1prz, 1.8 Å

PDB Description: crystal structure of pseudouridine synthase rlud catalytic module

PDB Compounds: (A:) Ribosomal large subunit pseudouridine synthase D

SCOPe Domain Sequences for d1prza_:

Sequence; same for both SEQRES and ATOM records:

>d1prza_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli [TaxId: 562]}
arfepqdipldivyedediivinkprdlvvhpgagnpdgtvlnallhyyppiadvpragi
vhrldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhpt
krthmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyg
grprppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmra
dfeehkdevdwl

Timeline for d1prza_:

• d1prza_ first appeared in SCOP 1.67
  
• d1prza_ appears in SCOP 1.75
  
• d1prza_ appears in SCOPe 2.02
  
• d1prza_ appears in the current release, SCOPe 2.08