Lineage for d1prza_ (1prz A:)

  1. Root: SCOP 1.67
  2. 405194Class d: Alpha and beta proteins (a+b) [53931] (260 folds)
  3. 423589Fold d.265: Pseudouridine synthase [100877] (1 superfamily)
    consists of two alpha+beta subdomains with some similarity to the ferredoxin-like fold
  4. 423590Superfamily d.265.1: Pseudouridine synthase [55120] (4 families) (S)
    the active site is the most conserved structural region of the superfamily and is located between the subdomains
  5. 423606Family d.265.1.3: Pseudouridine synthase RsuA/RluD [75459] (2 proteins)
    contains N-terminal alpha-L RNA-binding motif
  6. 423607Protein Ribosomal large subunit pseudouridine synthase D, RluD [103019] (1 species)
  7. 423608Species Escherichia coli [TaxId:562] [103020] (2 PDB entries)
  8. 423609Domain d1prza_: 1prz A: [95064]
    mutant

Details for d1prza_

PDB Entry: 1prz (more details), 1.8 Å

PDB Description: crystal structure of pseudouridine synthase rlud catalytic module

SCOP Domain Sequences for d1prza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1prza_ d.265.1.3 (A:) Ribosomal large subunit pseudouridine synthase D, RluD {Escherichia coli}
arfepqdipldivyedediivinkprdlvvhpgagnpdgtvlnallhyyppiadvpragi
vhrldkdttglmvvaktvpaqtrlveslqrreitreyeavaighmtaggtvdepisrhpt
krthmavhpmgkpavthyrimehfrvhtrlrlrletgrthqirvhmahithplvgdpvyg
grprppkgaseafistlrkfdrqalhatmlrlyhpisgiemewhapipqdmvelievmra
dfeehkdevdwl

SCOP Domain Coordinates for d1prza_:

Click to download the PDB-style file with coordinates for d1prza_.
(The format of our PDB-style files is described here.)

Timeline for d1prza_: