Lineage for d1pq8a_ (1pq8 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1318222Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 1318223Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 1318445Family b.47.1.2: Eukaryotic proteases [50514] (48 proteins)
  6. 1319321Protein Trypsin(ogen) [50515] (9 species)
  7. 1319750Species Fungus (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries)
  8. 1319759Domain d1pq8a_: 1pq8 A: [95003]
    complexed with cit, lys, so4

Details for d1pq8a_

PDB Entry: 1pq8 (more details), 1 Å

PDB Description: trypsin at ph 4 at atomic resolution
PDB Compounds: (A:) Trypsin

SCOPe Domain Sequences for d1pq8a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pq8a_ b.47.1.2 (A:) Trypsin(ogen) {Fungus (Fusarium oxysporum) [TaxId: 5507]}
ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr
tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv
agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds
ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya

SCOPe Domain Coordinates for d1pq8a_:

Click to download the PDB-style file with coordinates for d1pq8a_.
(The format of our PDB-style files is described here.)

Timeline for d1pq8a_: