![]() | Class b: All beta proteins [48724] (149 folds) |
![]() | Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
![]() | Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) ![]() |
![]() | Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
![]() | Protein Trypsin(ogen) [50515] (8 species) |
![]() | Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (12 PDB entries) |
![]() | Domain d1pq8a_: 1pq8 A: [95003] complexed with cit, lys, sul |
PDB Entry: 1pq8 (more details), 1 Å
SCOP Domain Sequences for d1pq8a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pq8a_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum)} ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
Timeline for d1pq8a_: