Class b: All beta proteins [48724] (165 folds) |
Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily) barrel, closed; n=6, S=8; greek-key duplication: consists of two domains of the same fold |
Superfamily b.47.1: Trypsin-like serine proteases [50494] (4 families) |
Family b.47.1.2: Eukaryotic proteases [50514] (47 proteins) |
Protein Trypsin(ogen) [50515] (9 species) |
Species Mold (Fusarium oxysporum) [TaxId:5507] [50521] (16 PDB entries) |
Domain d1pq7a_: 1pq7 A: [95002] complexed with arg, sul |
PDB Entry: 1pq7 (more details), 0.8 Å
SCOP Domain Sequences for d1pq7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pq7a_ b.47.1.2 (A:) Trypsin(ogen) {Mold (Fusarium oxysporum) [TaxId: 5507]} ivggtsasagdfpfivsisrnggpwcggsllnantvltaahcvsgyaqsgfqiragslsr tsggitsslssvrvhpsysgnnndlailklstsipsggnigyarlaasgsdpvagssatv agwgatseggsstpvnllkvtvpivsratcraqygtsaitnqmfcagvssggkdscqgds ggpivdssntligavswgngcarpnysgvyasvgalrsfidtya
Timeline for d1pq7a_: