SCOPe 2.06: Domain d1pn9b2: 1pn9 B:1-83

Lineage for d1pn9b2 (1pn9 B:1-83)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class delta GST [81366] (6 species)
   formerly a part of class theta enzymes

7. Species African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId:7165] [102441] (1 PDB entry)

8. Domain d1pn9b2: 1pn9 B:1-83 [94952]
   Other proteins in same PDB: d1pn9a1, d1pn9b1
   complexed with gtx

Details for d1pn9b2

PDB Entry: 1pn9, 2 Å

PDB Description: Crystal structure of an insect delta-class glutathione S-transferase from a DDT-resistant strain of the malaria vector Anopheles gambiae

PDB Compounds: (B:) Glutathione S-transferase 1-6

SCOPe Domain Sequences for d1pn9b2:

Sequence; same for both SEQRES and ATOM records:

>d1pn9b2 c.47.1.5 (B:1-83) Class delta GST {African malaria mosquito (Anopheles gambiae), isozyme 1-6 [TaxId: 7165]}
mdfyylpgsapcravqmtaaavgvelnlkltdlmkgehmkpeflklnpqhciptlvdngf
alwesraiqiylaekygkddkly

Timeline for d1pn9b2:

• d1pn9b2 first appeared in SCOP 1.67
  
• d1pn9b2 appears in SCOPe 2.05
  
• d1pn9b2 appears in SCOPe 2.07
  
• d1pn9b2 appears in the current release, SCOPe 2.08