Lineage for d1pmva_ (1pmv A:)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 734668Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 734669Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (7 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 734710Family d.144.1.7: Protein kinases, catalytic subunit [88854] (61 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 734769Protein c-jun N-terminal kinase (jnk3s) [56137] (1 species)
    CMGC group; ERK/MAPK subfamily; serine/threonine kinase
  7. 734770Species Human (Homo sapiens) [TaxId:9606] [56138] (11 PDB entries)
  8. 734776Domain d1pmva_: 1pmv A: [94916]
    complexed with 537

Details for d1pmva_

PDB Entry: 1pmv (more details), 2.5 Å

PDB Description: The structure of JNK3 in complex with a dihydroanthrapyrazole inhibitor
PDB Compounds: (A:) Mitogen-activated protein kinase 10

SCOP Domain Sequences for d1pmva_:

Sequence, based on SEQRES records: (download)

>d1pmva_ d.144.1.7 (A:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglartagtsfmmtpyv
vtryyrapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcp
efmkklqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidp
akrisvddalqhpyinvwydpaeveapppqiydkqlderehtieewkeliykevmn

Sequence, based on observed residues (ATOM records): (download)

>d1pmva_ d.144.1.7 (A:) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]}
dnqfysvevgdstftvlkryqnlkpigsgaqgivcaaydavldrnvaikklsrpfqnqth
akrayrelvlmkcvnhkniisllnvftpqktleefqdvylvmelmdanlcqviqmeldhe
rmsyllyqmlcgikhlhsagiihrdlkpsnivvksdctlkildfglasfmmtpyvvtryy
rapevilgmgykenvdiwsvgcimgemvrhkilfpgrdyidqwnkvieqlgtpcpefmkk
lqptvrnyvenrpkyagltfpklfpdslfpadsehnklkasqardllskmlvidpakris
vddalqhpyinvwydpaeveapppqqlderehtieewkeliykevmn

SCOP Domain Coordinates for d1pmva_:

Click to download the PDB-style file with coordinates for d1pmva_.
(The format of our PDB-style files is described here.)

Timeline for d1pmva_: