SCOP 1.69: Domain d1pm9b2: 1pm9 B:84-198

Lineage for d1pm9b2 (1pm9 B:84-198)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family)

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)

8. Domain d1pm9b2: 1pm9 B:84-198 [94900]
   Other proteins in same PDB: d1pm9a1, d1pm9b1

Details for d1pm9b2

PDB Entry: 1pm9, 1.7 Å

PDB Description: crystal structure of human mnsod h30n, y166f mutant

SCOP Domain Sequences for d1pm9b2:

Sequence; same for both SEQRES and ATOM records:

>d1pm9b2 d.44.1.1 (B:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayflqyknvrpdylkaiwnvinwenvterymackk

Timeline for d1pm9b2:

• d1pm9b2 first appeared in SCOP 1.67
  
• d1pm9b2 appears in SCOP 1.71
  
• d1pm9b2 appears in the current release, SCOPe 2.08