Lineage for d1ploa_ (1plo A:)

  1. Root: SCOP 1.67
  2. 427008Class g: Small proteins [56992] (72 folds)
  3. 428346Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 428347Superfamily g.7.1: Snake toxin-like [57302] (3 families) (S)
  5. 428503Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (4 proteins)
  6. 428517Protein TGF-beta type II receptor extracellular domain [69951] (2 species)
    elaborated with additional structures resulting in a beta-sandwich fold
  7. 428520Species Human (Homo sapiens) [TaxId:9606] [69952] (3 PDB entries)
  8. 428523Domain d1ploa_: 1plo A: [94886]
    mutant

Details for d1ploa_

PDB Entry: 1plo (more details)

PDB Description: transforming growth factor-beta type ii receptor extracellular domain

SCOP Domain Sequences for d1ploa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ploa_ g.7.1.3 (A:) TGF-beta type II receptor extracellular domain {Human (Homo sapiens)}
vtdnagavkfpqlckfcdvrfstcdnqkscmsncsitsicekpqevcvavwrkndenitl
etvchdpklpyhdfiledaaspkcimkekkkpgetffmcscssdecndniifseeyntsn
pd

SCOP Domain Coordinates for d1ploa_:

Click to download the PDB-style file with coordinates for d1ploa_.
(The format of our PDB-style files is described here.)

Timeline for d1ploa_: