Lineage for d1pl8a2 (1pl8 A:146-316)

  1. Root: SCOP 1.67
  2. 383641Class c: Alpha and beta proteins (a/b) [51349] (130 folds)
  3. 387036Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 387037Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (11 families) (S)
  5. 387038Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (12 proteins)
    N-terminal all-beta domain defines family
  6. 387258Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species)
  7. 387259Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries)
  8. 387264Domain d1pl8a2: 1pl8 A:146-316 [94879]
    Other proteins in same PDB: d1pl8a1, d1pl8b1, d1pl8c1, d1pl8d1

Details for d1pl8a2

PDB Entry: 1pl8 (more details), 1.9 Å

PDB Description: human SDH/NAD+ complex

SCOP Domain Sequences for d1pl8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens)}
vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls
atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs
ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn

SCOP Domain Coordinates for d1pl8a2:

Click to download the PDB-style file with coordinates for d1pl8a2.
(The format of our PDB-style files is described here.)

Timeline for d1pl8a2: