Lineage for d1pl7b1 (1pl7 B:1-145,B:317-356)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461906Fold b.35: GroES-like [50128] (2 superfamilies)
    contains barrel, partly opened; n*=4, S*=8; meander
  4. 461907Superfamily b.35.1: GroES-like [50129] (2 families) (S)
  5. 461986Family b.35.1.2: Alcohol dehydrogenase-like, N-terminal domain [50136] (13 proteins)
    C-terminal domain is alpha/beta (classical Rossmann-fold)
  6. 462216Protein Ketose reductase (sorbitol dehydrogenase) [50145] (2 species)
  7. 462217Species Human (Homo sapiens) [TaxId:9606] [101710] (3 PDB entries)
  8. 462219Domain d1pl7b1: 1pl7 B:1-145,B:317-356 [94872]
    Other proteins in same PDB: d1pl7a2, d1pl7b2, d1pl7c2, d1pl7d2

Details for d1pl7b1

PDB Entry: 1pl7 (more details), 2.2 Å

PDB Description: Human Sorbitol Dehydrogenase (apo)

SCOP Domain Sequences for d1pl7b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl7b1 b.35.1.2 (B:1-145,B:317-356) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens)}
aaaakpnnlslvvhgpgdlrlenypipepgpnevllrmhsvgicgsdvhyweygrignfi
vkkpmvlgheasgtvekvgssvkhlkpgdrvaiepgaprendefckmgrynlspsiffca
tppddgnlcrfykhnaafcyklpdnXvkplvthrfplekaleafetfkkglglkimlkcd
psdqnp

SCOP Domain Coordinates for d1pl7b1:

Click to download the PDB-style file with coordinates for d1pl7b1.
(The format of our PDB-style files is described here.)

Timeline for d1pl7b1: