Lineage for d1pl6a2 (1pl6 A:146-316)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2102557Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2102558Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2102559Family c.2.1.1: Alcohol dehydrogenase-like, C-terminal domain [51736] (17 proteins)
    N-terminal all-beta domain defines family
  6. 2102857Protein Ketose reductase (sorbitol dehydrogenase) [51745] (2 species)
  7. 2102858Species Human (Homo sapiens) [TaxId:9606] [102130] (3 PDB entries)
  8. 2102863Domain d1pl6a2: 1pl6 A:146-316 [94863]
    Other proteins in same PDB: d1pl6a1, d1pl6b1, d1pl6c1, d1pl6d1
    complexed with 572, nad, zn

Details for d1pl6a2

PDB Entry: 1pl6 (more details), 2 Å

PDB Description: Human SDH/NADH/inhibitor complex
PDB Compounds: (A:) sorbitol dehydrogenase

SCOPe Domain Sequences for d1pl6a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl6a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]}
vtfeegalieplsvgihacrrggvtlghkvlvcgagpigmvtllvakamgaaqvvvtdls
atrlskakeigadlvlqiskespqeiarkvegqlgckpevtiectgaeasiqagiyatrs
ggtlvlvglgsemttvpllhaairevdikgvfrycntwpvaismlasksvn

SCOPe Domain Coordinates for d1pl6a2:

Click to download the PDB-style file with coordinates for d1pl6a2.
(The format of our PDB-style files is described here.)

Timeline for d1pl6a2: