Lineage for d1pl4b1 (1pl4 B:1-83)

  1. Root: SCOP 1.75
  2. 758332Class a: All alpha proteins [46456] (284 folds)
  3. 760084Fold a.2: Long alpha-hairpin [46556] (20 superfamilies)
    2 helices; antiparallel hairpin, left-handed twist
  4. 760309Superfamily a.2.11: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46609] (1 family) (S)
  5. 760310Family a.2.11.1: Fe,Mn superoxide dismutase (SOD), N-terminal domain [46610] (3 proteins)
  6. 760436Protein Mn superoxide dismutase (MnSOD) [46618] (7 species)
  7. 760489Species Human (Homo sapiens) [TaxId:9606] [46619] (27 PDB entries)
  8. 760497Domain d1pl4b1: 1pl4 B:1-83 [94856]
    Other proteins in same PDB: d1pl4a2, d1pl4b2, d1pl4c2, d1pl4d2

Details for d1pl4b1

PDB Entry: 1pl4 (more details), 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant
PDB Compounds: (B:) Superoxide dismutase [Mn], mitochondrial

SCOP Domain Sequences for d1pl4b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl4b1 a.2.11.1 (B:1-83) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens) [TaxId: 9606]}
khslpdlpydygalephinaqimqlhhskhhaayvnnlnvteekyqealakgdvtaqial
qpalkfnggghinhsifwtnlsp

SCOP Domain Coordinates for d1pl4b1:

Click to download the PDB-style file with coordinates for d1pl4b1.
(The format of our PDB-style files is described here.)

Timeline for d1pl4b1: