Lineage for d1pl4a2 (1pl4 A:84-198)

  1. Root: SCOP 1.69
  2. 496776Class d: Alpha and beta proteins (a+b) [53931] (279 folds)
  3. 503030Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
    alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213
  4. 503031Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (1 family) (S)
  5. 503032Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (3 proteins)
  6. 503144Protein Mn superoxide dismutase (MnSOD) [54721] (6 species)
  7. 503188Species Human (Homo sapiens) [TaxId:9606] [54724] (14 PDB entries)
  8. 503189Domain d1pl4a2: 1pl4 A:84-198 [94855]
    Other proteins in same PDB: d1pl4a1, d1pl4b1, d1pl4c1, d1pl4d1

Details for d1pl4a2

PDB Entry: 1pl4 (more details), 1.47 Å

PDB Description: crystal structure of human mnsod y166f mutant

SCOP Domain Sequences for d1pl4a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pl4a2 d.44.1.1 (A:84-198) Mn superoxide dismutase (MnSOD) {Human (Homo sapiens)}
ngggepkgelleaikrdfgsfdkfkekltaasvgvqgsgwgwlgfnkerghlqiaacpnq
dplqgttglipllgidvwehayflqyknvrpdylkaiwnvinwenvterymackk

SCOP Domain Coordinates for d1pl4a2:

Click to download the PDB-style file with coordinates for d1pl4a2.
(The format of our PDB-style files is described here.)

Timeline for d1pl4a2: