SCOP 1.67: Domain d1pk8c1: 1pk8 C:113-213

Lineage for d1pk8c1 (1pk8 C:113-213)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (6 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.5: Synapsin domain [52463] (2 proteins)

6. Protein Synapsin I [52464] (2 species)

7. Species Rat (Rattus norvegicus) [TaxId:10116] [102287] (2 PDB entries)

8. Domain d1pk8c1: 1pk8 C:113-213 [94811]
   Other proteins in same PDB: d1pk8a2, d1pk8b2, d1pk8c2, d1pk8d2, d1pk8e2, d1pk8f2, d1pk8g2, d1pk8h2

Details for d1pk8c1

PDB Entry: 1pk8, 2.1 Å

PDB Description: Crystal Structure of Rat Synapsin I C Domain Complexed to Ca.ATP

SCOP Domain Sequences for d1pk8c1:

Sequence, based on SEQRES records:

>d1pk8c1 c.30.1.5 (C:113-213) Synapsin I {Rat (Rattus norvegicus)}
arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevlrngv
kvvrslkpdfvlirqhafsmarngdyrslviglqyagipsv

Sequence, based on observed residues (ATOM records):

>d1pk8c1 c.30.1.5 (C:113-213) Synapsin I {Rat (Rattus norvegicus)}
arvllvidephtdwakyfkgkkihgeidikveqaefsdlnlvahanggfsvdmevrslkp
dfvlirqhafsmarngdyrslviglqyagipsv

Timeline for d1pk8c1:

• d1pk8c1 is new in SCOP 1.67
  
• d1pk8c1 appears in SCOP 1.69
  
• d1pk8c1 appears in the current release, SCOPe 2.08