SCOPe 2.05: Domain d1pjqb1: 1pjq B:1-113

Lineage for d1pjqb1 (1pjq B:1-113)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.11: Siroheme synthase N-terminal domain-like [75110] (2 proteins)

6. Protein Siroheme synthase CysG, domain 1 [102163] (1 species)

7. Species Salmonella typhimurium [TaxId:90371] [102164] (3 PDB entries)

8. Domain d1pjqb1: 1pjq B:1-113 [94769]
   Other proteins in same PDB: d1pjqa2, d1pjqa3, d1pjqb2, d1pjqb3
   complexed with act, pge, sah

Details for d1pjqb1

PDB Entry: 1pjq, 2.21 Å

PDB Description: Structure and function of CysG, the multifunctional methyltransferase/dehydrogenase/ferrochelatase for siroheme synthesis

PDB Compounds: (B:) Siroheme synthase

SCOPe Domain Sequences for d1pjqb1:

Sequence; same for both SEQRES and ATOM records:

>d1pjqb1 c.2.1.11 (B:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]}
mdhlpifcqlrdrdclivgggdvaerkarllleagarltvnaltfipqftvwanegmltl
vegpfdetlldscwlaiaatdddtvnqrvsdaaesrrifcnvvdapkaasfim

Timeline for d1pjqb1:

• d1pjqb1 first appeared in SCOP 1.67
  
• d1pjqb1 appears in SCOPe 2.04
  
• d1pjqb1 appears in SCOPe 2.06
  
• d1pjqb1 appears in the current release, SCOPe 2.08