SCOP 1.69: Domain d1pj9a3: 1pj9 A:407-495

Lineage for d1pj9a3 (1pj9 A:407-495)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
   folded sheet; greek-key

4. Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families)
   this domain is C-terminal to the catalytic beta/alpha barrel domain

5. Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
   this domain follows the catalytic beta/alpha barrel domain

6. Protein Cyclodextrin glycosyltransferase [51018] (5 species)
   contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like

7. Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)

8. Domain d1pj9a3: 1pj9 A:407-495 [94756]
   Other proteins in same PDB: d1pj9a1, d1pj9a2, d1pj9a4

Details for d1pj9a3

PDB Entry: 1pj9, 2 Å

PDB Description: bacillus circulans strain 251 loop mutant 183-195

SCOP Domain Sequences for d1pj9a3:

Sequence; same for both SEQRES and ATOM records:

>d1pj9a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

Timeline for d1pj9a3:

• d1pj9a3 first appeared in SCOP 1.67
  
• d1pj9a3 appears in SCOP 1.71
  
• d1pj9a3 appears in the current release, SCOPe 2.08