Lineage for d1pj9a3 (1pj9 A:407-495)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 380059Fold b.71: Glycosyl hydrolase domain [51010] (1 superfamily)
    folded sheet; greek-key
  4. 380060Superfamily b.71.1: Glycosyl hydrolase domain [51011] (3 families) (S)
    this domain is C-terminal to the catalytic beta/alpha barrel domain
  5. 380061Family b.71.1.1: alpha-Amylases, C-terminal beta-sheet domain [51012] (21 proteins)
    this domain follows the catalytic beta/alpha barrel domain
  6. 380170Protein Cyclodextrin glycosyltransferase [51018] (5 species)
    contains two more all-beta domains in C-terminal region, Immunoglobulin-like and trasthyretin-like
  7. 380171Species Bacillus circulans, different strains [TaxId:1397] [51019] (36 PDB entries)
  8. 380174Domain d1pj9a3: 1pj9 A:407-495 [94756]
    Other proteins in same PDB: d1pj9a1, d1pj9a2, d1pj9a4
    complexed with acy, ca, glc, mal, mpd; mutant

Details for d1pj9a3

PDB Entry: 1pj9 (more details), 2 Å

PDB Description: bacillus circulans strain 251 loop mutant 183-195

SCOP Domain Sequences for d1pj9a3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj9a3 b.71.1.1 (A:407-495) Cyclodextrin glycosyltransferase {Bacillus circulans, different strains}
gstqerwinndvliyerkfgsnvavvavnrnlnapasisglvtslpqgsyndvlggllng
ntlsvgsggaasnftlaaggtavwqytaa

SCOP Domain Coordinates for d1pj9a3:

Click to download the PDB-style file with coordinates for d1pj9a3.
(The format of our PDB-style files is described here.)

Timeline for d1pj9a3: