SCOP 1.75: Domain d1pj9a2: 1pj9 A:582-686

Lineage for d1pj9a2 (1pj9 A:582-686)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.1: Starch-binding domain-like [49452] (3 families)

5. Family b.3.1.1: Starch-binding domain [49453] (3 proteins)

6. Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (6 species)
   this domain is the last one in the protein chain

7. Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)

8. Domain d1pj9a2: 1pj9 A:582-686 [94755]
   Other proteins in same PDB: d1pj9a1, d1pj9a3, d1pj9a4
   complexed with acy, ca, glc, mal, mpd; mutant

Details for d1pj9a2

PDB Entry: 1pj9, 2 Å

PDB Description: bacillus circulans strain 251 loop mutant 183-195

PDB Compounds: (A:) cyclomaltodextrin glucanotransferase

SCOP Domain Sequences for d1pj9a2:

Sequence; same for both SEQRES and ATOM records:

>d1pj9a2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains [TaxId: 1397]}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

Timeline for d1pj9a2:

• d1pj9a2 first appeared in SCOP 1.67
  
• d1pj9a2 appears in SCOP 1.73
  
• d1pj9a2 appears in SCOPe 2.01
  
• d1pj9a2 appears in the current release, SCOPe 2.08