Lineage for d1pj9a2 (1pj9 A:582-686)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 368613Fold b.3: Prealbumin-like [49451] (6 superfamilies)
    sandwich; 7 strands in 2 sheets, greek-key
    variations: some members have additional 1-2 strands to common fold
  4. 368614Superfamily b.3.1: Starch-binding domain [49452] (1 family) (S)
  5. 368615Family b.3.1.1: Starch-binding domain [49453] (3 proteins)
  6. 368647Protein Cyclodextrin glycosyltransferase, C-terminal domain [49454] (5 species)
    this domain is the last one in the protein chain
  7. 368648Species Bacillus circulans, different strains [TaxId:1397] [49455] (36 PDB entries)
  8. 368651Domain d1pj9a2: 1pj9 A:582-686 [94755]
    Other proteins in same PDB: d1pj9a1, d1pj9a3, d1pj9a4
    complexed with acy, ca, glc, mal, mpd; mutant

Details for d1pj9a2

PDB Entry: 1pj9 (more details), 2 Å

PDB Description: bacillus circulans strain 251 loop mutant 183-195

SCOP Domain Sequences for d1pj9a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj9a2 b.3.1.1 (A:582-686) Cyclodextrin glycosyltransferase, C-terminal domain {Bacillus circulans, different strains}
lsgdqvsvrfvvnnattalgqnvyltgsvselgnwdpakaigpmynqvvyqypnwyydvs
vpagktiefkflkkqgstvtweggsnhtftapssgtatinvnwqp

SCOP Domain Coordinates for d1pj9a2:

Click to download the PDB-style file with coordinates for d1pj9a2.
(The format of our PDB-style files is described here.)

Timeline for d1pj9a2: