SCOP 1.67: Domain d1pj4d2: 1pj4 D:3022-3279

Lineage for d1pj4d2 (1pj4 D:3022-3279)

1. Root: SCOP 1.67

2. Class c: Alpha and beta proteins (a/b) [51349] (130 folds)

3. Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
   core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134

4. Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families)

5. Family c.58.1.3: Mitochondrial NAD(P)-dependent malic enzyme [53240] (1 protein)
   this domain is decorated with additional structures; includes N-terminal additional subdomains and extra N-terminal strand

6. Protein Mitochondrial NAD(P)-dependent malic enzyme [53241] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [53242] (10 PDB entries)

8. Domain d1pj4d2: 1pj4 D:3022-3279 [94741]
   Other proteins in same PDB: d1pj4a1, d1pj4b1, d1pj4c1, d1pj4d1
   complexed with atp, fum, mlt, mn

Details for d1pj4d2

PDB Entry: 1pj4, 2.3 Å

PDB Description: Crystal structure of human mitochondrial NAD(P)+-dependent malic enzyme in a pentary complex with natural substrate malate, ATP, Mn++, and allosteric activator fumarate.

SCOP Domain Sequences for d1pj4d2:

Sequence; same for both SEQRES and ATOM records:

>d1pj4d2 c.58.1.3 (D:3022-3279) Mitochondrial NAD(P)-dependent malic enzyme {Human (Homo sapiens)}
kekgkplmlnprtnkgmaftlqerqmlglqgllppkietqdiqalrfhrnlkkmtsplek
yiyimgiqerneklfyrilqddieslmpivytptvglacsqyghifrrpkglfisisdrg
hvrsivdnwpenhvkavvvtdgerilglgdlgvygmgipvgklclytacagirpdrclpv
cidvgtdniallkdpfymglyqkrdrtqqyddlidefmkaitdrygrntliqfedfgnhn
afrflrkyrekyctfndd

Timeline for d1pj4d2:

• d1pj4d2 is new in SCOP 1.67
  
• d1pj4d2 appears in SCOP 1.69
  
• d1pj4d2 appears in the current release, SCOPe 2.08