Lineage for d1pj1b_ (1pj1 B:)

  1. Root: SCOP 1.73
  2. 631650Class a: All alpha proteins [46456] (258 folds)
  3. 638518Fold a.25: Ferritin-like [47239] (4 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 638519Superfamily a.25.1: Ferritin-like [47240] (5 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 639101Family a.25.1.2: Ribonucleotide reductase-like [47253] (8 proteins)
  6. 639250Protein Ribonucleotide reductase R2 [47257] (8 species)
  7. 639280Species Escherichia coli [TaxId:562] [47258] (23 PDB entries)
  8. 639300Domain d1pj1b_: 1pj1 B: [94717]
    complexed with fe, hg; mutant

Details for d1pj1b_

PDB Entry: 1pj1 (more details), 1.95 Å

PDB Description: ribonucleotide reductase r2-d84e/w48f soaked with ferrous ions at ph 5
PDB Compounds: (B:) Ribonucleoside-diphosphate reductase 1 beta chain

SCOP Domain Sequences for d1pj1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pj1b_ a.25.1.2 (B:) Ribonucleotide reductase R2 {Escherichia coli [TaxId: 562]}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsfffrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1pj1b_:

Click to download the PDB-style file with coordinates for d1pj1b_.
(The format of our PDB-style files is described here.)

Timeline for d1pj1b_: