Lineage for d1piza_ (1piz A:)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 353826Fold a.25: Ferritin-like [47239] (2 superfamilies)
    core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection
  4. 353827Superfamily a.25.1: Ferritin-like [47240] (3 families) (S)
    contains bimetal-ion centre in the middle of the bundle
  5. 354154Family a.25.1.2: Ribonucleotide reductase-like [47253] (5 proteins)
  6. 354256Protein Ribonucleotide reductase R2 [47257] (6 species)
  7. 354278Species Escherichia coli [TaxId:562] [47258] (21 PDB entries)
  8. 354293Domain d1piza_: 1piz A: [94712]

Details for d1piza_

PDB Entry: 1piz (more details), 1.9 Å

PDB Description: ribonucleotide reductase r2 d84e mutant soaked with ferrous ions at neutral ph

SCOP Domain Sequences for d1piza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1piza_ a.25.1.2 (A:) Ribonucleotide reductase R2 {Escherichia coli}
ayttfsqtkndqlkepmffgqpvnvarydqqkydifekliekqlsffwrpeevdvsrdri
dyqalpehekhifisnlkyqtllesiqgrspnvallplisipeletwvetwafsetihsr
sythiirnivndpsvvfddivtneqiqkraegissyydeliemtsywhllgegthtvngk
tvtvslrelkkklylclmsvnaleairfyvsfacsfafaerelmegnakiirliardeal
hltgtqhmlnllrsgaddpemaeiaeeckqecydlfvqaaqqekdwadylfrdgsmigln
kdilcqyveyitnirmqavgldlpfntrsnpipwintwlv

SCOP Domain Coordinates for d1piza_:

Click to download the PDB-style file with coordinates for d1piza_.
(The format of our PDB-style files is described here.)

Timeline for d1piza_: