SCOP 1.71: Domain d1piea2: 1pie A:214-396

Lineage for d1piea2 (1pie A:214-396)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.58: Ferredoxin-like [54861] (51 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.26: GHMP Kinase, C-terminal domain [55060] (7 families)
   common fold is elaborated with additional secondary structures

5. Family d.58.26.7: Galactokinase [103011] (1 protein)

6. Protein Galactokinase [103012] (3 species)

7. Species Lactococcus lactis [TaxId:1358] [103013] (1 PDB entry)

8. Domain d1piea2: 1pie A:214-396 [94707]
   Other proteins in same PDB: d1piea1
   complexed with gal, po4

Details for d1piea2

PDB Entry: 1pie, 2.1 Å

PDB Description: crystal structure of lactococcus lactis galactokinase complexed with galactose

SCOP Domain Sequences for d1piea2:

Sequence; same for both SEQRES and ATOM records:

>d1piea2 d.58.26.7 (A:214-396) Galactokinase {Lactococcus lactis}
dydivimntnkpralteskynerfaetrealkrmqtrldiqslgelsneefdantdligd
etlikrarhavyennrtkiaqkafvagnltkfgellnashaslkddyevtgleldtlaet
aqkqagvlgarmtgagfggcaialvahdnvsafrkavgqvyeevvgypasfyvaqigsgs
tkl

Timeline for d1piea2:

• d1piea2 first appeared in SCOP 1.67
  
• d1piea2 appears in SCOP 1.69
  
• d1piea2 appears in SCOP 1.73
  
• d1piea2 appears in the current release, SCOPe 2.08