SCOP 1.73: Domain d1pi5a_: 1pi5 A:

Lineage for d1pi5a_ (1pi5 A:)

1. Root: SCOP 1.73

2. Class e: Multi-domain proteins (alpha and beta) [56572] (53 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (3 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (16 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (39 PDB entries)

8. Domain d1pi5a_: 1pi5 A: [94702]

Details for d1pi5a_

PDB Entry: 1pi5, 1.49 Å

PDB Description: structure of n289a mutant of ampc in complex with sm2, carboxyphenylglycylboronic acid bearing the cephalothin r1 side chain

PDB Compounds: (A:) Beta-lactamase

SCOP Domain Sequences for d1pi5a_:

Sequence; same for both SEQRES and ATOM records:

>d1pi5a_ e.3.1.1 (A:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase [TaxId: 562]}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1pi5a_:

• d1pi5a_ first appeared in SCOP 1.67
  
• d1pi5a_ appears in SCOP 1.71
  
• d1pi5a_ appears in SCOP 1.75
  
• d1pi5a_ appears in the current release, SCOPe 2.08