SCOP 1.69: Domain d1pi4b_: 1pi4 B:

Lineage for d1pi4b_ (1pi4 B:)

1. Root: SCOP 1.69

2. Class e: Multi-domain proteins (alpha and beta) [56572] (46 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (2 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (12 proteins)

6. Protein AMPC beta-Lactamase, class C [56618] (3 species)
   contains small alpha+beta subdomain inserted in the common fold

7. Species Escherichia coli, cephalosporinase [TaxId:562] [56621] (32 PDB entries)

8. Domain d1pi4b_: 1pi4 B: [94701]

Details for d1pi4b_

PDB Entry: 1pi4, 1.39 Å

PDB Description: structure of n289a mutant of ampc in complex with sm3, a phenylglyclboronic acid bearing the cephalothin r1 side chain

SCOP Domain Sequences for d1pi4b_:

Sequence; same for both SEQRES and ATOM records:

>d1pi4b_ e.3.1.1 (B:) AMPC beta-Lactamase, class C {Escherichia coli, cephalosporinase}
apqqindivhrtitplieqqkipgmavaviyqgkpyyftwgyadiakkqpvtqqtlfelg
svsktftgvlggdaiargeiklsdpttkywpeltakqwngitllhlatytagglplqvpd
evksssdllrfyqnwqpawapgtqrlyanssiglfgalavkpsglsfeqamqtrvfqplk
lnhtwinvppaeeknyawgyregkavhvspgaldaeaygvkstiedmarwvqsnlkpldi
nektlqqgiqlaqsrywqtgdmyqglgwemldwpvnpdsiingsdakialaarpvkaitp
ptpavraswvhktgatggfgsyvafipekelgivmlanknypnparvdaawqilnalq

Timeline for d1pi4b_:

• d1pi4b_ first appeared in SCOP 1.67
  
• d1pi4b_ appears in SCOP 1.71
  
• d1pi4b_ appears in the current release, SCOPe 2.08