Lineage for d1pg7x1 (1pg7 X:1-113)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 546420Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (28 proteins)
  6. 546556Protein Immunoglobulin heavy chain variable domain, VH [88543] (20 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 546882Species Mouse (Mus musculus), cluster 3.2 [TaxId:10090] [88552] (148 PDB entries)
  8. 546986Domain d1pg7x1: 1pg7 X:1-113 [94684]
    Other proteins in same PDB: d1pg7h2, d1pg7i2, d1pg7l1, d1pg7l2, d1pg7m1, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z2

Details for d1pg7x1

PDB Entry: 1pg7 (more details), 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

SCOP Domain Sequences for d1pg7x1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pg7x1 b.1.1.1 (X:1-113) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 3.2}
evqlqqsgpelvkpgasvkisckasgysftghllnwvkqshgknlewiglvhphngaity
nqkfkdkatltvdrssttayielvrltsndsavyycaredfryhysmdywgqgtsvtvss

SCOP Domain Coordinates for d1pg7x1:

Click to download the PDB-style file with coordinates for d1pg7x1.
(The format of our PDB-style files is described here.)

Timeline for d1pg7x1: