SCOP 1.75: Domain d1pg7m1: 1pg7 M:1-107

Lineage for d1pg7m1 (1pg7 M:1-107)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (32 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (52 PDB entries)
   SQ NA # humanized antidoby; bactericidal Fab-h6831
   SQ NA # Humanized antibody
   SQ NA # humanized antibody
   SQ NA # engineered antibody
   SQ NA # humanized antidoby; bactericidal Fab-h6831 ! SQ NA # Humanized antibody ! SQ NA # humanized antibody ! SQ NA # engineered antibody

8. Domain d1pg7m1: 1pg7 M:1-107 [94680]
   Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l2, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x1, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z1, d1pg7z2
   part of humanized Fab D3H44 against human tissue factor

Details for d1pg7m1

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

PDB Compounds: (M:) humanized antibody D3H44

SCOP Domain Sequences for d1pg7m1:

Sequence; same for both SEQRES and ATOM records:

>d1pg7m1 b.1.1.1 (M:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

Timeline for d1pg7m1:

• d1pg7m1 first appeared in SCOP 1.67
  
• d1pg7m1 appears in SCOP 1.73
  
• d1pg7m1 appears in SCOPe 2.01
  
• d1pg7m1 appears in the current release, SCOPe 2.08