SCOP 1.67: Domain d1pg7l1: 1pg7 L:1-107

Lineage for d1pg7l1 (1pg7 L:1-107)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (24 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (14 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Engineered (including hybrid species) [88533] (27 PDB entries)

8. Domain d1pg7l1: 1pg7 L:1-107 [94678]
   Other proteins in same PDB: d1pg7h1, d1pg7h2, d1pg7i1, d1pg7i2, d1pg7l2, d1pg7m2, d1pg7w1, d1pg7w2, d1pg7x2, d1pg7y1, d1pg7y2, d1pg7z2

Details for d1pg7l1

PDB Entry: 1pg7, 2.5 Å

PDB Description: Murine 6A6 Fab in complex with humanized anti-Tissue Factor D3H44 Fab

SCOP Domain Sequences for d1pg7l1:

Sequence; same for both SEQRES and ATOM records:

>d1pg7l1 b.1.1.1 (L:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Engineered (including hybrid species)}
diqmtqspsslsasvgdrvtitcrasrdiksylnwyqqkpgkapkvliyyatslaegvps
rfsgsgsgtdytltisslqpedfatyyclqhgespwtfgqgtkveik

Timeline for d1pg7l1:

• d1pg7l1 is new in SCOP 1.67
  
• d1pg7l1 appears in SCOP 1.69
  
• d1pg7l1 appears in the current release, SCOPe 2.08