Lineage for d1pg2a2 (1pg2 A:4-125,A:185-388)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) 
Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
contains a conserved all-alpha subdomain at the C-terminal extension
Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species) Species Escherichia coli [TaxId:562] [52386] (9 PDB entries) 
Domain d1pg2a2: 1pg2 A:4-125,A:185-388 [94672]
Other proteins in same PDB: d1pg2a1
protein/RNA complex; complexed with adn, met
Details for d1pg2a2
PDB Entry: 1pg2 (more details), 1.75 Å
PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionine and adenosine
PDB Compounds: (A:) Methionyl-tRNA synthetaseSCOPe Domain Sequences for d1pg2a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pg2a2 c.26.1.1 (A:4-125,A:185-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
isXrdsehfffdlpsfsemlqawtrsgalqeqvankmqewfesglqqwdisrdapyfgfe
ipnapgkyfyvwldapigymgsfknlcdkrgdsvsfdeywkkdstaelyhfigkdivyfh
slfwpamlegsnfrkpsnlfvhgyvtvngakmsksrgtfikastwlnhfdadslryyyta
klssriddidlnledfvqrvnadivnk
SCOPe Domain Coordinates for d1pg2a2:
Click to download the PDB-style file with coordinates for d1pg2a2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pg2a2:
- d1pg2a2 first appeared in SCOP 1.67
- d1pg2a2 appears in SCOPe 2.07
View in 3D
