Lineage for d1pfya3 (1pfy A:141-175)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2587435Fold g.41: Rubredoxin-like [57769] (17 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 2587436Superfamily g.41.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57770] (1 family) (S)
  5. 2587437Family g.41.1.1: Methionyl-tRNA synthetase (MetRS), Zn-domain [57771] (1 protein)
    in the Pyrococcus abyssi MetRS structure there is a tandem repeat of two such domains swapped with their zinc-binding 'knuckles', this duplicated finger occupies a larger region (124-183) than defined below; there is a structurally equivalent region in the E. coli enzyme lacking the second zinc-binding site
  6. 2587438Protein Methionyl-tRNA synthetase (MetRS), Zn-domain [57772] (2 species)
  7. 2587439Species Escherichia coli [TaxId:562] [57773] (9 PDB entries)
  8. 2587443Domain d1pfya3: 1pfy A:141-175 [94668]
    Other proteins in same PDB: d1pfya1, d1pfya2
    protein/RNA complex; complexed with msp, zn

Details for d1pfya3

PDB Entry: 1pfy (more details), 1.93 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with methionyl sulphamoyl adenosine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfya3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfya3 g.41.1.1 (A:141-175) Methionyl-tRNA synthetase (MetRS), Zn-domain {Escherichia coli [TaxId: 562]}
vkgtcpkckspdqygdncevcgatyspteliepks

SCOPe Domain Coordinates for d1pfya3:

Click to download the PDB-style file with coordinates for d1pfya3.
(The format of our PDB-style files is described here.)

Timeline for d1pfya3: