Lineage for d1pfva2 (1pfv A:4-140,A:176-388)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2860044Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 2860045Superfamily c.26.1: Nucleotidylyl transferase [52374] (6 families) (S)
  5. 2860046Family c.26.1.1: Class I aminoacyl-tRNA synthetases (RS), catalytic domain [52375] (13 proteins)
    contains a conserved all-alpha subdomain at the C-terminal extension
  6. 2860125Protein Methionyl-tRNA synthetase (MetRS) [52384] (3 species)
  7. 2860126Species Escherichia coli [TaxId:562] [52386] (9 PDB entries)
  8. 2860127Domain d1pfva2: 1pfv A:4-140,A:176-388 [94661]
    Other proteins in same PDB: d1pfva1, d1pfva3
    protein/RNA complex; complexed with 2fm, zn

Details for d1pfva2

PDB Entry: 1pfv (more details), 1.7 Å

PDB Description: methionyl-trna synthetase from escherichia coli complexed with difluoromethionine
PDB Compounds: (A:) Methionyl-tRNA synthetase

SCOPe Domain Sequences for d1pfva2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pfva2 c.26.1.1 (A:4-140,A:176-388) Methionyl-tRNA synthetase (MetRS) {Escherichia coli [TaxId: 562]}
akkilvtcalpyangsihlghmlehiqadvwvryqrmrghevnficaddahgtpimlkaq
qlgitpeqmigemsqehqtdfagfnisydnyhsthseenrqlseliysrlkengfiknrt
isqlydpekgmflpdrfXvvsgatpvmrdsehfffdlpsfsemlqawtrsgalqeqvank
mqewfesglqqwdisrdapyfgfeipnapgkyfyvwldapigymgsfknlcdkrgdsvsf
deywkkdstaelyhfigkdivyfhslfwpamlegsnfrkpsnlfvhgyvtvngakmsksr
gtfikastwlnhfdadslryyytaklssriddidlnledfvqrvnadivnk

SCOPe Domain Coordinates for d1pfva2:

Click to download the PDB-style file with coordinates for d1pfva2.
(The format of our PDB-style files is described here.)

Timeline for d1pfva2: