Lineage for d1pf9j3 (1pf9 J:137-190,J:367-409)

  1. Root: SCOP 1.71
  2. 595667Class d: Alpha and beta proteins (a+b) [53931] (286 folds)
  3. 603057Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. 603058Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. 603059Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. 603060Protein GroEL, I domain [54851] (4 species)
  7. 603061Species Escherichia coli [TaxId:562] [54852] (9 PDB entries)
  8. 603134Domain d1pf9j3: 1pf9 J:137-190,J:367-409 [94635]
    Other proteins in same PDB: d1pf9a1, d1pf9a2, d1pf9b1, d1pf9b2, d1pf9c1, d1pf9c2, d1pf9d1, d1pf9d2, d1pf9e1, d1pf9e2, d1pf9f1, d1pf9f2, d1pf9g1, d1pf9g2, d1pf9h1, d1pf9h2, d1pf9i1, d1pf9i2, d1pf9j1, d1pf9j2, d1pf9k1, d1pf9k2, d1pf9l1, d1pf9l2, d1pf9m1, d1pf9m2, d1pf9n1, d1pf9n2, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_

Details for d1pf9j3

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp

SCOP Domain Sequences for d1pf9j3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9j3 d.56.1.1 (J:137-190,J:367-409) GroEL, I domain {Escherichia coli}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOP Domain Coordinates for d1pf9j3:

Click to download the PDB-style file with coordinates for d1pf9j3.
(The format of our PDB-style files is described here.)

Timeline for d1pf9j3:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pf9a1, d1pf9a2, d1pf9a3, d1pf9b1, d1pf9b2, d1pf9b3, d1pf9c1, d1pf9c2, d1pf9c3, d1pf9d1, d1pf9d2, d1pf9d3, d1pf9e1, d1pf9e2, d1pf9e3, d1pf9f1, d1pf9f2, d1pf9f3, d1pf9g1, d1pf9g2, d1pf9g3, d1pf9h1, d1pf9h2, d1pf9h3, d1pf9i1, d1pf9i2, d1pf9i3, d1pf9k1, d1pf9k2, d1pf9k3, d1pf9l1, d1pf9l2, d1pf9l3, d1pf9m1, d1pf9m2, d1pf9m3, d1pf9n1, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_