Lineage for d1pf9i2 (1pf9 I:191-366)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 689773Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
    3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
    this domain is thought to be mobile in most multi-domain proteins known to contain it
  4. 689924Superfamily c.8.5: GroEL apical domain-like [52029] (2 families) (S)
  5. 689925Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (1 protein)
  6. 689926Protein GroEL, A domain [52031] (4 species)
  7. 689927Species Escherichia coli [TaxId:562] [52032] (16 PDB entries)
  8. 690010Domain d1pf9i2: 1pf9 I:191-366 [94631]
    Other proteins in same PDB: d1pf9a1, d1pf9a3, d1pf9b1, d1pf9b3, d1pf9c1, d1pf9c3, d1pf9d1, d1pf9d3, d1pf9e1, d1pf9e3, d1pf9f1, d1pf9f3, d1pf9g1, d1pf9g3, d1pf9h1, d1pf9h3, d1pf9i1, d1pf9i3, d1pf9j1, d1pf9j3, d1pf9k1, d1pf9k3, d1pf9l1, d1pf9l3, d1pf9m1, d1pf9m3, d1pf9n1, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_

Details for d1pf9i2

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp
PDB Compounds: (I:) groEL protein

SCOP Domain Sequences for d1pf9i2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9i2 c.8.5.1 (I:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

SCOP Domain Coordinates for d1pf9i2:

Click to download the PDB-style file with coordinates for d1pf9i2.
(The format of our PDB-style files is described here.)

Timeline for d1pf9i2:

View in 3D
Domains from other chains:
(mouse over for more information)
d1pf9a1, d1pf9a2, d1pf9a3, d1pf9b1, d1pf9b2, d1pf9b3, d1pf9c1, d1pf9c2, d1pf9c3, d1pf9d1, d1pf9d2, d1pf9d3, d1pf9e1, d1pf9e2, d1pf9e3, d1pf9f1, d1pf9f2, d1pf9f3, d1pf9g1, d1pf9g2, d1pf9g3, d1pf9h1, d1pf9h2, d1pf9h3, d1pf9j1, d1pf9j2, d1pf9j3, d1pf9k1, d1pf9k2, d1pf9k3, d1pf9l1, d1pf9l2, d1pf9l3, d1pf9m1, d1pf9m2, d1pf9m3, d1pf9n1, d1pf9n2, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_