SCOPe 2.04: Domain d1pf9e2: 1pf9 E:191-366

Lineage for d1pf9e2 (1pf9 E:191-366)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.8: The "swivelling" beta/beta/alpha domain [52008] (10 superfamilies)
   3 layers: b/b/a; the central sheet is parallel, and the other one is antiparallel; there are some variations in topology
   this domain is thought to be mobile in most multi-domain proteins known to contain it

4. Superfamily c.8.5: GroEL apical domain-like [52029] (3 families)

5. Family c.8.5.1: GroEL-like chaperone, apical domain [52030] (2 proteins)

6. Protein GroEL, A domain [52031] (4 species)

7. Species Escherichia coli [TaxId:562] [52032] (18 PDB entries)

8. Domain d1pf9e2: 1pf9 E:191-366 [94619]
   Other proteins in same PDB: d1pf9a1, d1pf9a3, d1pf9b1, d1pf9b3, d1pf9c1, d1pf9c3, d1pf9d1, d1pf9d3, d1pf9e1, d1pf9e3, d1pf9f1, d1pf9f3, d1pf9g1, d1pf9g3, d1pf9h1, d1pf9h3, d1pf9i1, d1pf9i3, d1pf9j1, d1pf9j3, d1pf9k1, d1pf9k3, d1pf9l1, d1pf9l3, d1pf9m1, d1pf9m3, d1pf9n1, d1pf9n3, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_
   complexed with adp, mg

Details for d1pf9e2

PDB Entry: 1pf9, 2.99 Å

PDB Description: groel-groes-adp

PDB Compounds: (E:) groEL protein

SCOPe Domain Sequences for d1pf9e2:

Sequence; same for both SEQRES and ATOM records:

>d1pf9e2 c.8.5.1 (E:191-366) GroEL, A domain {Escherichia coli [TaxId: 562]}
egmqfdrgylspyfinkpetgavelespfilladkkisniremlpvleavakagkpllii
aedvegealatlvvntmrgivkvaavkapgfgdrrkamlqdiatltggtviseeigmele
katledlgqakrvvinkdtttiidgvgeeaaiqgrvaqirqqieeatsdydreklq

Timeline for d1pf9e2:

• d1pf9e2 first appeared in SCOP 1.67
  
• d1pf9e2 appears in SCOPe 2.03
  
• d1pf9e2 appears in SCOPe 2.05
  
• d1pf9e2 appears in the current release, SCOPe 2.08