Lineage for d1pf9d3 (1pf9 D:137-190,D:367-409)

  1. Root: SCOPe 2.08
  2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. Fold d.56: GroEL-intermediate domain like [54848] (1 superfamily)
    3-helical bundle packed against 3-stranded mixed beta-sheet
  4. Superfamily d.56.1: GroEL-intermediate domain like [54849] (2 families) (S)
  5. Family d.56.1.1: GroEL-like chaperone, intermediate domain [54850] (1 protein)
  6. Protein GroEL, I domain [54851] (4 species)
  7. Species Escherichia coli [TaxId:562] [54852] (11 PDB entries)
  8. Domain d1pf9d3: 1pf9 D:137-190,D:367-409 [94617]
    Other proteins in same PDB: d1pf9a1, d1pf9a2, d1pf9b1, d1pf9b2, d1pf9c1, d1pf9c2, d1pf9d1, d1pf9d2, d1pf9e1, d1pf9e2, d1pf9f1, d1pf9f2, d1pf9g1, d1pf9g2, d1pf9h1, d1pf9h2, d1pf9i1, d1pf9i2, d1pf9j1, d1pf9j2, d1pf9k1, d1pf9k2, d1pf9l1, d1pf9l2, d1pf9m1, d1pf9m2, d1pf9n1, d1pf9n2, d1pf9o_, d1pf9p_, d1pf9q_, d1pf9r_, d1pf9s_, d1pf9t_, d1pf9u_
    complexed with adp, mg

Details for d1pf9d3

PDB Entry: 1pf9 (more details), 2.99 Å

PDB Description: groel-groes-adp
PDB Compounds: (D:) groEL protein

SCOPe Domain Sequences for d1pf9d3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1pf9d3 d.56.1.1 (D:137-190,D:367-409) GroEL, I domain {Escherichia coli [TaxId: 562]}
pcsdskaiaqvgtisansdetvgkliaeamdkvgkegvitvedgtglqdeldvvXervak
laggvavikvgaatevemkekkarvedalhatraavee

SCOPe Domain Coordinates for d1pf9d3 are not available.

Timeline for d1pf9d3: